Cat: IPD-X50155

Recombinant Mouse RAB18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB18;Ras-related Protein Rab-18

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35293

  • Expression Region

    1-206aa

  • AA Sequence

    MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL

  • Molecular Weight

    23,0kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB18 is a member of the Rab family of small GTPases, which play crucial roles in intracellular vesicle trafficking and membrane dynamics. Research on RAB18 has gained prominence due to its involvement in various cellular processes and its association with several diseases, particularly hereditary disorders like choroideremia and some forms of childhood obesity. The protein is primarily localized to the endoplasmic reticulum and lipid droplets, indicating its potential role in lipid metabolism and storage. Studies have shown that RAB18 regulates the formation and maturation of lipid droplets, which are essential for maintaining cellular energy balance and responding to metabolic stress. Additionally, RAB18 is implicated in the transport of proteins and lipids between cellular compartments, making it a key player in maintaining cellular homeostasis. Due to its critical functions, RAB18 has become a target for investigating therapeutic strategies for metabolic diseases and understanding the molecular mechanisms underlying lipid-related disorders. The generation of recombinant RAB18 proteins has facilitated detailed biochemical and structural studies, paving the way for elucidating its precise mechanisms of action and interactions within cellular pathways. As a result, the study of RAB18 not only enhances our knowledge of basic cellular functions but also opens avenues for potential clinical applications in treating metabolic and neurodegenerative diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US