Cat: PA1000-2609

Recombinant Human RAB17 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB17;Ras-related Protein Rab-17

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H0T7

  • Expression Region

    1-212aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAQAHRTPQPRAAPSQPRVFKLVLLGSGSV GKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLEIWDTAGQEKY HSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLV GNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQEL LQRSDEEGQALRGDAAVALNKGPARQAKCCAH

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB17 is a member of the RAS oncogene family, primarily involved in intracellular vesicle trafficking and sorting processes. Research has shown that RAB17 plays a crucial role in various cellular functions, including endocytosis, exocytosis, and the maintenance of cellular morphology. Its expression is particularly noteworthy in epithelial tissues, where it influences the transport of proteins and lipids essential for cell polarization and function. Studies have indicated that alterations in RAB17 expression levels are associated with several pathological conditions, including cancer, where it may contribute to tumor progression and metastasis by altering the cellular microenvironment. Additionally, RAB17's involvement in the immune response suggests that it may play a role in inflammatory diseases. Given its critical functions and implications in disease, the production of RAB17 recombinant proteins enables researchers to investigate its biochemical properties, interactions with other cellular components, and potential as a therapeutic target. By better understanding RAB17's mechanisms, scientists aim to explore its potential roles in disease processes and develop strategies for intervention, highlighting the significance of studying this protein in both basic and applied research contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US