Analytical Data
-
Gene name
MTHFD1L
- Application
-
Alternative Names
10-formyl-THF synthetase; C1TM_HUMAN; Formyltetrahydrofolate synthetase; formyltetrahydrofolate synthetase domain containing 1; FTHFSDC1; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like; mitochondrial; Monofunctional C1-tetrahydrofolate synthase; MTC1THFS; MTHFD1L; RP1-292B18.2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UB35
-
Expression Region
1-366 aa
-
AA Sequence
MAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF
-
Molecular Weight
65.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTHFD1L (Methylenetetrahydrofolate dehydrogenase 1-like) is an essential enzyme involved in the folate pathway, playing a critical role in cellular metabolism and one-carbon transfer reactions. It is primarily located in the mitochondria, where it catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a crucial step in the synthesis of nucleotides and, subsequently, DNA. Abnormalities in MTHFD1L expression or function have been linked to various diseases, including cancer and neurological disorders, highlighting its importance in health and disease. Research into recombinant MTHFD1L protein has gained momentum to better understand its biochemical properties, mechanisms of action, and potential as a therapeutic target. Producing this protein through recombinant DNA technology allows scientists to obtain large quantities of the enzyme for in-depth structural and functional studies. Furthermore, studying the interactions of MTHFD1L with other cellular components could elucidate its role in metabolic pathways and disease progression. Understanding the regulation of MTHFD1L is also critical, as modifications in its activity can lead to altered folate metabolism and contribute to pathophysiological conditions. Thus, the investigation of recombinant MTHFD1L serves not only to expand our understanding of basic cellular processes but also to inform potential interventions in diseases associated with dysregulated folate metabolism. The comprehensive study of this enzyme could pave the way for novel therapeutic strategies and enhance our understanding of metabolic regulation at a cellular level.
