Cat: IPD-X50103

Recombinant Human PINK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PINK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PINK1;Serine/threonine-Protein kinase PINK1. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXM7

  • Expression Region

    262~507aa

  • AA Sequence

    KRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLF LVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNIL VELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARP GPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPES VPPDVRQLVRALLQREASKRPSARVAANVL

  • Molecular Weight

    30.6kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PINK1 (PTEN-induced putative kinase 1) is a serine/threonine kinase that plays a crucial role in mitochondrial quality control and the regulation of cell death pathways. Mutations in the PINK1 gene are associated with autosomal recessive forms of Parkinson's disease, highlighting its significance in neurodegenerative disorders. PINK1 functions by sensing mitochondrial dysfunction and initiating protective mechanisms, including the activation of the Parkin protein, which tags damaged mitochondria for degradation through mitophagy. The study of recombinant PINK1 protein has gained momentum due to its potential therapeutic implications and the need for a better understanding of its enzymatic activity and interaction with other mitochondrial proteins. Researchers are focused on overexpressing and purifying PINK1 in various systems to study its structure, function, and biochemical characteristics. This research is essential for elucidating the molecular mechanisms underlying PINK1-related pathologies and may lead to novel strategies for the treatment of Parkinson's disease and other mitochondrial dysfunction-associated conditions. By understanding the biological pathways mediated by PINK1, scientists aim to develop targeted therapies that can enhance mitochondrial function and protect neuronal health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US