Analytical Data
-
Gene name
OVOL3
- Application
-
Alternative Names
OVOL3；Putative transcription factor ovo-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00110
-
Expression Region
1-214aa
-
AA Sequence
MPRAFLVRSRRPQPPNWGHLPDQLRGDAYIPGGPLTVPGGKGQERRSVTIWLFSSDCSSLGGPPAQQSSSVRDPWTAQPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRALHRAA
-
Molecular Weight
31.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OVOL3, a member of the Ovo-like family of transcription factors, has gained significant attention due to its roles in various biological processes, including cell differentiation, embryogenesis, and the regulation of gene expression. Found predominantly in the testis and with implications in male fertility, OVOL3 is known to be involved in spermatogenesis and the maintenance of spermatogonial stem cells. Recent studies highlight its potential involvement in cancer biology, particularly in testicular germ cell tumors, where it may act as a tumor suppressor or have dual roles depending on the cellular context. The study of OVOL3 as a recombinant protein offers valuable insights into its structure-function relationships, interactions with other proteins, and potential signaling pathways. By analyzing the protein's behavior in vitro, researchers aim to uncover its specific mechanisms of action and therapeutic potentials, especially for conditions related to fertility and cancer. Moreover, recombinant OVOL3 could serve as a tool for drug development and the creation of targeted therapies, making it a focal point of current biomedical research. Through these investigations, OVOL3's relevance in both basic and applied sciences is becoming increasingly evident, paving the way for novel strategies in reproductive health and oncology.
