Analytical Data
-
Gene name
MGAT5B
- Application
-
Alternative Names
MGAT5B; KIAA2008Alpha-1.6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B; EC 2.4.1.-; EC 2.4.1.155; Alpha-mannoside beta-1.6-N-acetylglucosaminyltransferase B; GlcNAc-T Vb; GNT-Vb; hGnTVb; Mannoside acetylglucosaminyltransferase 5B; N-acetylglucosaminyl-transferase Vb; N-acetylglucosaminyltransferase IX; GNT-IX
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3V5L5
-
Expression Region
1-394 aa
-
AA Sequence
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT
-
Molecular Weight
70.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGAT5B, a member of the MGAT (mannosyltransferase) family, plays a crucial role in glycosylation, specifically in the synthesis of complex N-glycans. This enzyme is known for its ability to catalyze the addition of mannose residues to glycoproteins, which is essential for proper protein folding, stability, and function. Alterations in MGAT5B activity have been linked to various pathological conditions, including cancer, where changes in glycosylation patterns can influence tumor progression and immune response. The study of recombinant MGAT5B protein is vital for understanding its enzymatic function and the implications of its activity in disease. By producing this protein through recombinant techniques, researchers can analyze its biochemical properties, investigate its role in N-glycan biosynthesis, and explore potential therapeutic applications. Additionally, recombinant MGAT5B can serve as a valuable tool for studying glycoprotein modifications and their effects on cellular interactions and signaling pathways, thereby providing insights into the critical impacts of glycosylation in biology and medicine. As such, the exploration of MGAT5B through recombinant protein technology continues to be a significant area of interest within glycobiology and functional genomics.
