Analytical Data
-
Gene name
PIN4
- Application
-
Alternative Names
PIN4;Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y237-2
-
Expression Region
1-156aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKG KSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAM EKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSG MDKPVFTDPPVKTKFGYHIIMVEGRK
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIN4, or Phosphatase Interacting Protein 4, is a critical component in the study of protein-protein interactions and cellular signaling pathways. It has garnered attention due to its role in mediating the effects of various phosphatases, which are essential for dephosphorylating proteins and regulating numerous cellular processes, including cell division, differentiation, and stress responses. The research surrounding PIN4 focuses on its functions within different cellular contexts, particularly in plant systems where it is implicated in hormone signaling pathways and responses to environmental stimuli. Current studies aim to elucidate the molecular mechanisms by which PIN4 influences these interactions, including its impact on key developmental processes and stress tolerance in plants. By understanding the structure-function relationship of PIN4 and its interacting partners, researchers hope to develop novel strategies for enhancing plant resilience and improving agricultural yields. The ongoing exploration of PIN4 not only contributes to the fundamental knowledge of plant biology but also holds potential implications for biotechnology and crop improvement, particularly in the face of global challenges such as climate change and food security. As such, the investigation into PIN4 and its associated pathways remains a vibrant and essential field of research with wide-ranging biological significance and practical applications.
