Cat: IPD-X50075

Recombinant Mouse ACSL4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACSL4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACSL4;ACS4;FACL4;LACS4;Long-chain-fatty-acid--CoA ligase 4

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9QUJ7

  • Expression Region

    100-581aa

  • AA Sequence

    EILSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKPKNTI AIFCETRAEWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEASYLITSVEL LESKLKAALVDINCVKHIIYVDNKTINRAEYPEGLEIHSMQSVEELGAKPENLS VPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTY IGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPT LMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLCNLI LFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTV TEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYF KNEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGE

  • Molecular Weight

    56.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACSL4 (acyl-CoA synthetase long-chain family member 4) is a key enzyme involved in lipid metabolism, specifically in the activation of long-chain fatty acids for subsequent metabolic processes. The importance of ACSL4 has gained recognition due to its diverse roles in cellular functions, including energy production, membrane synthesis, and signaling pathways. Research has increasingly focused on the implications of ACSL4 in various physiological and pathological contexts, particularly its involvement in cancer, neurodegenerative diseases, and metabolic disorders. Elevated expression levels of ACSL4 have been associated with aggressive tumor phenotypes, leading to interest in its potential as a therapeutic target or biomarker. Furthermore, the enzyme's role in the regulation of fatty acid oxidation and inflammation has positioned it as a significant player in understanding metabolic diseases, such as obesity and diabetes. The study of recombinant ACSL4 protein has become fundamental to elucidate its structure-function relationships, enabling the exploration of inhibitor development and therapeutic interventions. By generating and characterizing recombinant ACSL4, researchers aim to dissect its enzymatic mechanisms, interactions with other cellular components, and overall contribution to metabolic dysregulation. This research not only enhances our understanding of ACSL4's biological functions but also opens avenues for innovative strategies in treating related diseases. Thus, the investigation of ACSL4 presents a promising frontier in biochemical research, with implications for health and disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US