Analytical Data
-
Gene name
OR10G8
- Application
-
Alternative Names
OR10G8; Olfactory receptor 10G8; Olfactory receptor OR11-282
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGN5
-
Expression Region
1-311 aa
-
AA Sequence
MSNASLLTAFILMGLPHAPALDAPLFGVFLVVYVLTVLGNLLILLVIRVDSHLHTTMYYFLTNLSFIDMWFSTVTVPKLLMTLVFPSGRAISFHSCMAQLYFFHFLGGTECFLYRVMSCDRYLAISYPLRYTSMMTGRSCTLLATSTWLSGSLHSAVQAILTFHLPYCGPNWIQHYLCDAPPILKLACADTSAIETVIFVTVGIVASGCFVLIVLSYVSIVCSILRIRTSEGKHRAFQTCASHCIVVLCFFGPGLFIYLRPGSRKAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKVAHSQSK
-
Molecular Weight
60.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10G8 is a member of the olfactory receptor gene family, which is known for its role in the sense of smell. Olfactory receptors are G protein-coupled receptors expressed in the nasal epithelium, where they detect odorant molecules and initiate olfactory signaling pathways. The OR10G8 gene, like many others in this family, has received significant attention because of its potential implications in various biological processes, including chemosensation, homeostasis, and potentially even behavioral responses. Recent studies suggest that variants of olfactory receptors may be involved in individual differences in olfactory perception and preferences. Additionally, understanding the function and signaling mechanisms of OR10G8 could provide insights into the interactions between environmental stimuli and the nervous system, as well as their implications for human health and disease. Given the intricate relationship between olfactory perception and many aspects of human behavior and physiology, the exploration of OR10G8 and its recombinant protein holds promise for elucidating the complex molecular underpinnings of the olfactory system and could have potential applications in developing novel therapeutic strategies for olfactory disorders and enhancing sensory-driven marketing strategies. Thus, research into OR10G8 and its recombinant forms continues to be a significant area of interest for both basic science and applied research.
