Cat: PA1000-2974

Recombinant Human SNRPC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNRPC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNRPC;U1 small nuclear ribonucleoProtein C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09234

  • Expression Region

    1-159aa

  • AA Sequence

    MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLI DKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGP PMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT RPGMTRPDR

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNRPC, or Small Nuclear Ribonucleoprotein Polypeptide C, is a crucial component of the spliceosomal machinery in eukaryotic cells, playing a vital role in the splicing of pre-mRNA. The study of SNRPC is significant due to its implications in gene regulation, RNA processing, and various cellular functions. Alterations in SNRPC expression or function can lead to a range of diseases, including cancer and neurodegenerative disorders, highlighting the need for a deeper understanding of its structure and mechanisms. Research has shown that SNRPC is involved in the assembly of spliceosomal complexes and interacts with various RNA and protein factors, which are essential for accurate splicing. Moreover, recent studies have suggested that SNRPC may also have roles in other cellular processes beyond splicing, such as transcription regulation and maintaining cellular homeostasis. This expanding knowledge of SNRPC's multifaceted roles underscores its importance as a target for therapeutic intervention and as a subject of study in the fields of molecular biology and genetics. Understanding the molecular dynamics and interactions of SNRPC can potentially lead to new strategies for treating diseases associated with spliceosomal dysfunctions. Thus, ongoing research is focused on elucidating the structural characteristics of SNRPC and its interactions in the context of the spliceosome and beyond, aiming to contribute to the broader field of RNA biology and its implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US