Cat: PA2000-9858

Recombinant Human OR10G9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR10G9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR10G9; OR10G10P; Olfactory receptor 10G9; Olfactory receptor 10G10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGN4

  • Expression Region

    1-311 aa

  • AA Sequence

    MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD RYLAISYPLRYTSMMSGSRCALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDA PPILKLACADTSANEMVIFVDIGLVASGCFLLIVLSYVSIVCSILRIHTSEGRHRAFQTC ASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK LRDKVAHSQGE

  • Molecular Weight

    34.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR10G9 is a member of the olfactory receptor gene family, which plays a critical role in the perception of odors in vertebrates. As a G-protein-coupled receptor, OR10G9 is involved in the initial steps of the olfactory signaling pathway, where it interacts with specific odorant molecules, triggering a cascade of intracellular responses. The study of OR10G9 and its recombinant protein form has gained attention due to its potential implications in understanding olfactory mechanisms and sensory biology. Additionally, research indicates that variations in olfactory receptor genes may be linked to differences in scent perception among individuals, which can influence behaviors such as food selection, mate choice, and environmental awareness. Recombinant expression of OR10G9 can facilitate functional assays to characterize its ligand specificity, signaling pathways, and structural properties. This knowledge could provide insights into not only the fundamental aspects of the olfactory system but also its evolutionary significance and potential biomedical applications, such as developing sensor technologies or therapeutic strategies for olfactory disorders. Furthermore, a deeper understanding of OR10G9 could contribute to the broader field of sensory biology, highlighting the intricate relationships between genetic variation, protein function, and complex behavior. Overall, the exploration of OR10G9 as a recombinant protein represents a promising avenue for advancing our comprehension of olfactory receptors and their role in sensory perception.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US