Cat: IPD-X50061

Recombinant Human TXNIP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TXNIP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TXNIP;VDUP1;Thioredoxin-interacting Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H3M7

  • Expression Region

    32-367aa

  • AA Sequence

    IVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGE NEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQET KKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGD EISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTC ASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSG LSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDM DGSQDSPIFMYA

  • Molecular Weight

    41.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TXNIP (thioredoxin-interacting protein) is a crucial signaling molecule that has garnered significant attention in the fields of diabetes and cardiovascular research due to its role in cellular redox regulation and glucose metabolism. Initially characterized as a modulator of the thioredoxin system, TXNIP is known to interact with thioredoxin, thereby inhibiting its antioxidant functions. Elevated levels of TXNIP have been associated with oxidative stress, inflammation, and apoptosis, particularly in diabetic conditions. Recent studies have highlighted its involvement in regulating insulin signaling and glucose homeostasis, suggesting that TXNIP may serve as a critical link between oxidative stress and metabolic disorders. Research has focused on the development of recombinant TXNIP proteins to elucidate its functional mechanisms and potential therapeutic applications. By producing and studying these recombinant proteins, researchers aim to dissect the molecular pathways mediated by TXNIP, investigate its role in the progression of insulin resistance, and explore novel intervention strategies to mitigate its adverse effects. This area of study not only enhances our understanding of TXNIP’s biological functions but also opens new avenues for targeting TXNIP-related pathways in treating metabolic diseases, thereby contributing to the development of innovative therapies for conditions such as type 2 diabetes and cardiovascular diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US