Analytical Data
-
Gene name
GSTM4
- Application
-
Alternative Names
GSTM4;Glutathione S-transferase Mu 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03013
-
Expression Region
1-218aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSMTLGYWDIRGLAHAIRLLLEYTDSSYEE KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI ARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEE LPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSTM4, a member of the glutathione S-transferase (GST) enzyme family, has garnered significant attention in the field of molecular biology due to its role in detoxification processes and cellular protection from oxidative stress. This protein is involved in the conjugation of glutathione to a wide range of substrates, including chemotherapeutic agents, environmental toxins, and other endogenous compounds, thereby facilitating their excretion from the body. Variations in GSTM4 expression and activity have been linked to individual susceptibility to various diseases, including cancer, and may influence therapeutic responses to drugs. As such, understanding the structural and functional characteristics of GSTM4 through recombinant protein studies can provide insights into its biological roles and potential clinical applications. Recent advancements in recombinant DNA technology enable the production of GSTM4 in heterologous systems, allowing for detailed analyses of its enzymatic properties, substrate specificity, and interactions with other proteins. These studies are crucial for elucidating the molecular mechanisms by which GSTM4 contributes to cellular defense and for identifying potential biomarkers for drug response and disease predisposition. Overall, research on GSTM4 recombinant protein not only enhances our understanding of the fundamental processes of detoxification but also paves the way for novel therapeutic strategies targeting GST pathways in various diseases.
