Analytical Data
-
Gene name
HOXC8
- Application
-
Alternative Names
Homeo box 3A; Homeo box 8; Homeobox 3A; Homeobox C8; Homeobox protein Hox C8; Homeobox protein Hox-3A; Homeobox protein Hox-C8; Homeobox protein HoxC8; Homeobox protein R4; Homolog of mouse Hox 3.1; HOX 3; Hox 3.1 mouse homolog of; HOX 3A; HOX C8; Hox-3.1; Hox-3A; HOX3; HOX3A; HOXC 8; Hoxc-8; HOXC8; HXC8_HUMAN; M31
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31273
-
Expression Region
1-242aa
-
AA Sequence
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
-
Molecular Weight
54.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXC8, a member of the Homeobox gene family, plays a crucial role in embryonic development and is involved in various biological processes, including cell differentiation and tissue patterning. Research on HOXC8 recombinant protein has gained attention due to its potential implications in developmental biology and disease. Studies have shown that aberrations in HOXC8 expression can be linked to certain cancers and developmental disorders, making it a significant focus for understanding malignancies and genetic pathologies. By producing HOXC8 as a recombinant protein, researchers aim to investigate its structural and functional characteristics in vitro, allowing for a better understanding of its molecular interactions and regulatory mechanisms. This could lead to identifying novel therapeutic targets and strategies for manipulating HOXC8's activity, paving the way for advancements in regenerative medicine and cancer treatment. The exploration of HOXC8's role in gene regulation and its interaction with other proteins expands our knowledge of the genetic networks governing development and disease. As such, HOXC8 recombinant protein serves as both a valuable research tool and a potential biomarker in the clinical setting, offering insights into the underlying mechanisms of various biological processes.
