Analytical Data
-
Gene name
GATAD1
- Application
-
Alternative Names
GATAD1; ODAG; GATA zinc finger domain-containing protein 1; Ocular development-associated gene protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUU5
-
Expression Region
1-269aa
-
AA Sequence
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL
-
Molecular Weight
55.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GATAD1 (GATA zinc finger domain containing 1) is a member of the GATA transcription factor family, known for its role in regulating gene expression during development and differentiation. Recent studies have highlighted GATAD1's involvement in various biological processes, including hematopoiesis and cell fate determination, as well as its potential link to certain diseases, such as cancer and autoimmune disorders. The protein's ability to bind specific DNA sequences and interact with other transcription factors underscores its importance in transcriptional regulation. Given its diverse functions, researchers are increasingly focused on producing and characterizing recombinant GATAD1 as a means to elucidate its mechanisms of action and regulatory pathways. Recombinant protein studies enable scientists to investigate GATAD1's structural properties, functional domains, and interactions with target genes in vitro, providing insights that are crucial for understanding its biological significance. This research is not only essential for comprehending GATAD1's role in normal physiology but also for exploring its potential as a therapeutic target in disease contexts. The development of methods for efficient protein expression and purification is a key aspect of this research, facilitating the generation of high-quality recombinant GATAD1 for various experimental applications. Overall, the study of GATAD1 recombinant protein embodies a convergence of molecular biology, biochemistry, and clinical research, promising to advance our understanding of transcriptional regulation and its implications in health and disease.
