Cat: PA2000-7909

Recombinant Human GAST Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GAST

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GAST. GAS

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01350

  • Expression Region

    1-101aa

  • AA Sequence

    MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

  • Molecular Weight

    37.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on GAST (Gastrin-related peptide) recombinant proteins has gained significant attention in the field of molecular biology and biomedical sciences due to their crucial role in various physiological processes. GAST is known to be involved in the regulation of gastric acid secretion, gastrointestinal function, and the modulation of endocrine and neuroendocrine activities. Its implications in health and disease, particularly in conditions such as gastritis, peptic ulcers, and certain types of cancers, make it a vital subject for study. Recombinant technologies allow for the production of this peptide in a controlled environment, facilitating detailed investigations into its structure-function relationships, biological activities, and potential therapeutic applications. The ability to generate GAST in recombinant form also opens avenues for exploring its interactions within biological systems and developing targeted treatments for related disorders. Additionally, elucidating the signaling pathways mediated by GAST can provide insights into its role as a biomarker for disease and a target for drug development. Overall, the research into GAST recombinant proteins not only deepens our understanding of gastrointestinal physiology but also holds promise for advancing therapeutic strategies in gastrointestinal diseases and beyond.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US