Cat: PA1000-8663

Recombinant Human HDAC9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HDAC9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HDAC9;HDAC7;HDAC7B;HDRP;Histone deacetylase 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UKV0

  • Expression Region

    548-1011aa

  • AA Sequence

    KEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGM DGLEKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCV CGNSTTHPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEH HSLLYGTNPLDGQKLDPRILLGDDSQKFFSSLPCGGLGVDSDTIWNELHS SGAARMAVGCVIELASKVASGELKNGFAVVRPPGHHAEESTAMGFCFFNS VAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYISLHRYDE GNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKP VAKEFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGR VVLALEGGHDLTAICDASEACVNALLGNELEPLAEDILHQSPNMNAVISL QKIIEIQSMSLKFS

  • Molecular Weight

    77 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Histone deacetylases (HDACs) play a crucial role in the regulation of gene expression through the removal of acetyl groups from lysine residues on histone proteins, influencing chromatin structure and function. HDAC9, a member of the Class II HDAC family, has garnered significant attention due to its involvement in various physiological and pathological processes, including development, inflammation, and cancer. Unlike Class I HDACs, Class II HDACs, including HDAC9, are characterized by their ability to be regulated by cellular signaling pathways and can shuttle between the nucleus and cytoplasm, affecting gene expression in a context-dependent manner. Recent studies have highlighted HDAC9's role beyond histone modification, indicating its involvement in the regulation of non-coding RNAs and interaction with transcription factors that could influence cellular responses. The growing body of evidence suggests that HDAC9 may serve as a potential therapeutic target for diseases where HDAC activity is dysregulated. Recombining HDAC9 protein facilitates the investigation of its structure-function relationship, enzymatic activity, and interaction with other biomolecules, ultimately aiding in the development of HDAC inhibitors as therapeutic agents. Understanding the molecular mechanisms by which HDAC9 operates in different cellular contexts could be instrumental in identifying novel strategies for treatment in cancer and other diseases associated with aberrant gene expression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US