Analytical Data
-
Gene name
USP45
- Application
-
Alternative Names
USP45; Ubiquitin carboxyl-terminal hydrolase 45; EC 3.4.19.12; Deubiquitinating enzyme 45; Ubiquitin thioesterase 45; Ubiquitin-specific-processing protease 45
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q70EL2
-
Expression Region
1-289 aa
-
AA Sequence
MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDPLVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKRVHLHLI
-
Molecular Weight
59.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
USP45 (Ubiquitin Specific Peptidase 45) is a member of the deubiquitinating enzyme family, which plays a critical role in the regulation of protein ubiquitylation, a post-translational modification that controls various cellular processes, including protein degradation, signal transduction, and cell division. Understanding the function of USP45 is crucial, as dysregulation of deubiquitinating enzymes is implicated in several diseases, including cancer, neurodegenerative disorders, and autoimmune conditions. Recent studies have suggested that USP45 may have specific roles in enhancing the stability of certain proteins, thereby influencing cellular signaling pathways and promoting cell survival under stress conditions. Additionally, its expression patterns have been linked to various tissues and developmental stages, highlighting its potential as a therapeutic target. Investigating the mechanisms by which USP45 exerts its effects, including identifying its substrate proteins and interaction partners, is essential for uncovering its biological functions. Furthermore, with the increasing interest in targeted therapies for cancer, elucidating the role of USP45 may offer novel insights into therapeutic strategies aimed at modulating protein degradation pathways. Overall, research on USP45 recombinant protein promises to provide valuable information on its biological roles and potential applications in medicine.
