Analytical Data
-
Gene name
H3
- Application
-
Alternative Names
H3；H3F3C；Histone H3.3C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68431
-
Expression Region
2-136aa
-
AA Sequence
MMHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL QEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant H3 protein has emerged as a significant area of research within the fields of molecular biology and biochemistry, primarily due to its critical role in chromatin structure and function. Histone H3, as a core component of nucleosomes, is integral to the packaging of DNA into chromatin, influencing gene expression, DNA replication, and repair processes. Advances in recombinant DNA technology have enabled the production of H3 protein in heterologous systems, allowing for the study of its structure-function relationships and post-translational modifications, such as methylation and phosphorylation, which are crucial for regulating various cellular processes. Researchers have focused on understanding the impact of specific H3 variants and their modifications on chromatin dynamics, transcriptional regulation, and cellular differentiation. Additionally, the potential links between H3 modifications and various diseases, including cancer, have spurred investigations into therapeutic strategies aimed at targeting these pathways. Consequently, the study of recombinant H3 protein not only enhances our fundamental understanding of epigenetic regulation but also opens avenues for innovative treatments that could manipulate chromatin states for therapeutic benefit. This blend of basic and applied research underscores the importance of H3 in both normal biology and disease, making it a focal point for ongoing scientific inquiry.
