Analytical Data
-
Gene name
LRRC3C
- Application
-
Alternative Names
LRRC3C；Leucine-rich repeat-containing Protein 3C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NJW4
-
Expression Region
1-275aa
-
AA Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLPLLLVIGTGGTVPSPQVPPRGCYVAKEAGERTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSGAAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPGTGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLMVAYLVHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
-
Molecular Weight
29.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC3C (Leucine-Rich Repeat Containing 3C) is a member of the leucine-rich repeat protein family, which plays essential roles in various cellular processes, including cell signaling, adhesion, and immune response. Recent studies have implicated LRRC3C in the regulation of key biological functions, such as cell proliferation, differentiation, and apoptosis. Given its potential involvement in various diseases, including cancer and autoimmune disorders, understanding the role and mechanism of action of LRRC3C has become increasingly important. Recombining LRRC3C into a protein form allows researchers to investigate its structural properties, interaction with other proteins, and functional implications in greater detail. Additionally, recombinant LRRC3C can serve as a valuable tool for developing therapeutic strategies aimed at modulating its activity, providing insights that could lead to novel interventions in diseases where LRRC3C is a contributing factor. Overall, the study of recombinant LRRC3C protein holds significant promise for advancing our understanding of its biological roles and potential therapeutic applications.
