Analytical Data
-
Gene name
UBIAD1
- Application
-
Alternative Names
UbiA prenyltransferase domain-containing Protein 1. EC:2.5.1.-. EC:2.5.1.39. Transitional epithelial response Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5Z9
-
Expression Region
1-338 aa
-
AA Sequence
MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI
-
Molecular Weight
63.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBIAD1 (UbiA Prenyltransferase Domain Containing 1) is a protein that has garnered significant attention due to its roles in various biological processes, including cholesterol metabolism, oxidative stress response, and cellular signaling. This protein is involved in the biosynthesis of vitamin K2, which is essential for several physiological functions, including blood coagulation and bone metabolism. Research has shown that mutations in the UBIAD1 gene are associated with a rare genetic disorder, KCTS (Keratitis-ichthyosis-deafness syndrome), highlighting its importance in human health. The recombinant expression of UBIAD1 allows for the study of its functional characteristics, potential interactions with other proteins, and its role in disease mechanisms. By producing UBIAD1 in a controlled laboratory setting, researchers can investigate its enzymatic activities, structural properties, and the impact of specific mutations on its function. This work aids in the development of therapeutic strategies for conditions linked to UBIAD1 dysfunction and contributes to the broader understanding of the protein's role in cellular physiology. Thus, the study of recombinant UBIAD1 holds promise not only for elucidating the biochemical pathways it participates in but also for potential applications in biotechnology and medicine.
