Analytical Data
-
Gene name
ZNF765
- Application
-
Alternative Names
ZNF765; Zinc finger Protein 765
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L2R6
-
Expression Region
1-60 aa
-
AA Sequence
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLELSGECPLAAPAS
-
Molecular Weight
6.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF765 (Zinc Finger Protein 765) is a member of the zinc finger protein family, which plays critical roles in gene regulation, cellular differentiation, and development. Recent studies have highlighted its potential involvement in various biological processes and diseases, including cancer and neurological disorders. The protein is characterized by its unique zinc finger motifs, which facilitate DNA binding and transcriptional regulation. Research has shown that ZNF765 can modulate the expression of target genes, affecting cell proliferation and survival. Understanding its structure and function is essential for elucidating its role in cellular mechanisms. The recombinant expression of ZNF765 provides a valuable tool for functional studies, enabling researchers to investigate its interactions, post-translational modifications, and impact on cellular pathways. As the demand for targeted therapies increases, elucidating the pathways influenced by ZNF765 could reveal new therapeutic targets, particularly in tumors where its expression is altered. Consequently, producing and characterizing ZNF765 as a recombinant protein is an important step towards unveiling its biological significance and therapeutic potential.
