Analytical Data
-
Gene name
ZNF764
- Application
-
Alternative Names
Zfp764; Zinc finger Protein 764; ZN764_HUMAN; ZNF764
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96H86
-
Expression Region
1-408 aa
-
AA Sequence
MAPPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPADSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRHGCYVCGKSFAWRSTLVEHVYSHTGEKPFHCTDCGKGFGHASSLSKHRAIHRGERPHRCLECGRAFTQRSALTSHLRVHTGEKPYGCADCGRRFSQSSALYQHRRVHSGETPFPCPDCGRAFAYPSDLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAVHRRTHSGEKPYPCPQCGRRFGQKSAVAKHQWVHRPGAGGHRGRVAGRLSVTLTPGHGDLDPPVGFQLYPEIFQECG
-
Molecular Weight
71.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF764 (Zinc Finger Protein 764) is a member of the zinc finger transcription factor family, which plays a crucial role in various biological processes, including gene regulation, cellular differentiation, and development. Recent studies have highlighted its involvement in several physiological functions and potentially pathological conditions, such as cancer and neurodegenerative diseases. The structural uniqueness of ZNF764, particularly its zinc finger motifs, suggests a high binding affinity to specific DNA sequences, allowing it to modulate target gene expression. Research into the recombinant protein of ZNF764 aims to elucidate its functional properties and interaction mechanisms within cells. This includes understanding its role in transcriptional regulation and identifying downstream targets that contribute to the cellular response. Recombinant ZNF764 can be produced in heterologous systems, facilitating detailed biochemical and biophysical analyses. Additionally, studying this protein could provide insights into its potential as a biomarker for disease or a target for therapeutic interventions. The ongoing exploration of ZNF764 not only enhances our understanding of transcriptional regulation but also underscores its importance in maintaining cellular homeostasis and addressing disease mechanisms.
