Analytical Data
-
Gene name
ZNF707
- Application
-
Alternative Names
ZNF707Zinc finger Protein 707
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96C28
-
Expression Region
1-369 aa
-
AA Sequence
MAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCADCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHLGFFTRHQRTHRHGEV
-
Molecular Weight
69.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF707, a member of the Zinc Finger protein family, has been a focus of research due to its potential roles in gene regulation and development. Zinc Finger proteins are known for their ability to bind DNA and RNA, influencing transcriptional activity, and ZNF707 is hypothesized to play a critical role in various biological processes, including embryogenesis and cellular differentiation. Studies suggest that ZNF707 may be implicated in certain diseases, particularly because of its involvement in transcriptional regulation pathways that are crucial for normal cellular function. Further exploration of ZNF707's structure and functional mechanisms, particularly through the production of recombinant proteins, is essential for understanding its biological significance and therapeutic potential. The recombinant ZNF707 protein can serve as a valuable tool for investigating its interactions with other cellular components and elucidating its role in gene expression modulation. This research not only contributes to our understanding of ZNF707's function but also holds promise for uncovering novel therapeutic targets in diseases related to dysregulation of transcription factors.
