Analytical Data
-
Gene name
ZNF706
- Application
-
Alternative Names
ZNF706; HSPC038; PNAS-113; Zinc finger Protein 706
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5V0
-
Expression Region
1-76 aa
-
AA Sequence
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
-
Molecular Weight
8.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF706, a member of the zinc finger protein family, has garnered attention due to its potential roles in gene regulation and cellular processes. Research has indicated that zinc finger proteins often function as transcription factors, influencing various biological pathways, including development, differentiation, and disease progression. The study of ZNF706 is particularly significant as it has been linked to critical cellular functions, suggesting its involvement in pathologies such as cancer and neurological disorders. The recombinant protein form of ZNF706 provides a powerful tool for investigating its structure-function relationships, enabling researchers to explore its molecular interactions and regulatory mechanisms in a controlled environment. Understanding the biochemical properties of ZNF706 through recombinant technology is essential for elucidating its precise role in cellular mechanisms and could potentially lead to novel therapeutic strategies. With the ongoing advancements in proteomics and structural biology, the detailed characterization of ZNF706 and its interactions with other biomolecules can shed light on its functional importance in health and disease, paving the way for targeted interventions in disorders where ZNF706 dysfunction is implicated.
