Analytical Data
-
Gene name
ZNF69
- Application
-
Alternative Names
ZNF69Zinc finger Protein 69; hZNF3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UC07
-
Expression Region
1-149 aa
-
AA Sequence
MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIKDDSHCGETFTQVPDDRLNFQEKKASPEIKSCDSFVCGEVGLGNSSFNMNIRGDIGHKAYEYQEYGPKP
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF69, a member of the zinc finger protein family, is increasingly recognized for its potential roles in gene regulation and cellular processes. With the growing understanding of its involvement in various biological pathways, including those related to immune responses and cancer development, researchers have turned their attention to the production of recombinant ZNF69 protein. This process enables the examination of its functional properties and interactions at a molecular level. The use of recombinant DNA technology to express ZNF69 in host systems not only allows for the generation of sufficient quantities of the protein for in vitro studies but also facilitates investigations into its structural characteristics and biochemical activities. Furthermore, the exploration of post-translational modifications and protein folding patterns provides insights into how ZNF69 exerts its effects within cells. Overall, the study of recombinant ZNF69 protein is crucial for elucidating its biological significance, paving the way for potential therapeutic applications, and advancing our understanding of the intricate networks involved in cellular regulation.
