Analytical Data
-
Gene name
ZNF562
- Application
-
Alternative Names
FLJ20079; MGC126160; Zinc finger Protein 562; ZN562_HUMAN; ZNF562
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6V9R5
-
Expression Region
1-426 aa
-
AA Sequence
MSAFDMSHGFFPREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDTTQKYLYRDVMLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRSYSGWKLCENCGEVFSEQFCLKTHMRAQNGGNTFEGNCYGKDSISVHKEASIGQELSKFNPCGKVFTLTPGLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGIHIGEKLCEFQECERAITTSSHLKQCVAVHTGKKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNSSSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLKTHSGER
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF562, a member of the zinc finger protein family, has garnered attention due to its potential roles in transcriptional regulation, cellular differentiation, and disease pathology, particularly in cancer. Zinc finger proteins, characterized by their ability to bind DNA and other molecules through zinc-coordinating domains, are crucial for maintaining cellular function and stability. Research indicates that ZNF562 may be involved in critical biological processes, such as gene expression and signal transduction, influencing various cellular responses. Studies suggest that aberrations in ZNF562 expression or function could be linked to oncogenic pathways, highlighting its significance in tumor biology. Consequently, understanding the structure and function of ZNF562 through recombinant protein studies is essential for elucidating its biological roles and therapeutic potential. By producing ZNF562 as a recombinant protein, researchers aim to characterize its binding properties, interaction partners, and functional mechanisms, ultimately contributing to the development of targeted therapies in cancer treatment and providing insights into the molecular underpinnings of diseases associated with zinc finger proteins. This research not only enhances the fundamental understanding of ZNF562 itself but also paves the way for exploring its implications in broader physiological and pathological contexts.
