Analytical Data
-
Gene name
ZNF561
- Application
-
Alternative Names
ZNF561; Zinc finger Protein 561
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N587
-
Expression Region
1-417 aa
-
AA Sequence
MLENYMNLASVEWEIQPRTKRSSLQQGFLKNQIFSGIQMTRGYSGWKLCDCKNCGEVFREQFCLKTHMRVQNGGNTSEGNCYGKDTLSVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLNARQPYKCKECGKGFKYFASLDNHMGIHTDEKLCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSFTNFSQLYAPVKTHKGEKSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECGQAFAQYSGLSIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKHLKTHSGEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYECKDMSVTI
-
Molecular Weight
45.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF561, a member of the Kruppel-like zinc finger protein family, has garnered attention in recent years due to its potential roles in various biological processes and human diseases. This protein is characterized by its unique structure, featuring multiple zinc finger motifs that facilitate DNA binding and transcriptional regulation. Initial studies have suggested that ZNF561 may play a crucial role in cell differentiation, proliferation, and apoptosis, making it a candidate for investigation in cancer biology and developmental disorders. Furthermore, mutations and dysregulation of ZNF561 expression have been linked to several pathological conditions, prompting researchers to explore its mechanisms of action in cellular environments. The production of recombinant ZNF561 protein enables the detailed study of its functional properties and interactions, paving the way for the development of potential therapeutic interventions. Advances in protein expression systems and purification techniques have enhanced the feasibility of obtaining sufficient quantities of functional ZNF561, allowing for in vitro assays and in vivo studies that can elucidate its biological significance. As such, the research surrounding ZNF561 recombinant protein not only contributes to a deeper understanding of its role in health and disease but also opens new avenues for targeted therapies in conditions associated with ZNF561 dysregulation.
