Analytical Data
-
Gene name
LMAN1
- Application
-
Alternative Names
LMAN1；ERGIC53；F5F8D；；Protein ERGIC-53
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49257
-
Expression Region
31-477aa
-
AA Sequence
DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLS
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMAN1 (Lectin Mannose-binding 1) is a type II membrane protein primarily located in the endoplasmic reticulum (ER) and is critically involved in the glycoprotein quality control process. It recognizes and binds to misfolded glycoproteins, facilitating their retrotranslocation from the ER to the cytosol for degradation via the ubiquitin-proteasome pathway. Mutations in the LMAN1 gene have been linked to various diseases, including a form of congenital disorder known as combined deficiency of coagulation factors, which highlights the importance of LMAN1 in maintaining proper hemostasis. Research on LMAN1 recombinant protein has gained momentum due to its potential therapeutic implications, especially in developing treatments for diseases caused by glycoprotein misfolding. Understanding the structural and functional properties of LMAN1 can reveal insights into its role in cell biology and pathology. The production of LMAN1 as a recombinant protein allows for detailed biochemical studies, which can further elucidate its mechanisms of action, interactions with other cellular components, and its involvement in disease pathways. This research not only enhances our fundamental understanding of protein quality control but also opens new avenues for therapeutic interventions targeting glycoprotein-related disorders.
