Analytical Data
-
Gene name
ZNF502
- Application
-
Alternative Names
ZNF502; Zinc finger Protein 502
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBZ5
-
Expression Region
1-544 aa
-
AA Sequence
MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQKKSWKCNECGKTFTQSSSLTQHQRTHTGERPYTCEECGKAFSRSSFLVQHQRIHTGVKPYGCEQCGKTFRCRSFLTQHQRIHTGEKPYKCNECGNSFRNHSHLTEHQRIHTGEKPYKCNRCGKAFNQNTHLIHHQRIHTGEKPYICSECGSSFRKHSNLTQHQRIHTGEKPHKCDECGKTFQTKANLSQHQRIHSGEKPYKCKECGKAFCQSPSLIKHQRIHTGEKPYKCKECGKAFTQSTPLTKHQRIHTGERPYKCSECGKAFIQSICLIRHQRSHTGEKPYKCNECGKGFNQNTCLTQHMRIHTGEKPYKCKECGKAFAHSSSLTEHHRTHTGEKLYKCSECEKTFRKYAHLSEHYRIHTGEKPYECIECGKFFRHSSVLFRHQKLHSGD
-
Molecular Weight
89.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF502, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in gene regulation and cellular processes. Zinc finger proteins are characterized by their ability to bind DNA, RNA, and other proteins, often functioning as transcription factors that influence gene expression. Research has suggested that ZNF502 may be involved in critical biological functions, such as development, differentiation, and stress responses. Its expression patterns indicate a potential role in various tissues and developmental stages, hinting at a regulatory significance that warrants further investigation. Despite its importance, comprehensive studies on ZNF502 remain limited, particularly regarding its biochemical properties and cellular functions. The development of recombinant ZNF502 protein provides a powerful tool for elucidating the molecular mechanisms underlying its activity. By generating this protein in an experimental setting, researchers can perform functional assays, structural studies, and interaction analyses to better understand how ZNF502 may contribute to disease processes or developmental disorders. Understanding ZNF502's role could reveal new insights into gene regulation networks and identify potential therapeutic targets for related pathologies. Therefore, the recombinant protein studies of ZNF502 are crucial for advancing our knowledge of its functions and implications in health and disease.
