Analytical Data
-
Gene name
FAM79B
- Application
-
Alternative Names
TPRG1; FAM79B; Tumor protein p63-regulated gene 1 protein; Protein FAM79B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZUI0
-
Expression Region
1-275aa
-
AA Sequence
MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF
-
Molecular Weight
57.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM79B, a member of the FAM79 (family with sequence similarity 79) gene family, has gained attention in recent years due to its potential role in various biological processes and diseases. This protein is characterized by its involvement in cellular signaling and regulation, particularly in the context of immune response and neuronal function. Research has indicated that FAM79B may act as a scaffold protein, facilitating interactions between signaling molecules and thereby influencing pathways related to inflammation and neuroprotection. Its expression levels have been associated with certain pathologies, including autoimmune disorders and neurodegenerative diseases. Consequently, recombinant FAM79B protein has become a focus for studying its functional roles and mechanisms of action in cells. Understanding its structure and interactions at a molecular level could pave the way for the development of novel therapies targeting diseases where FAM79B is implicated. The ability to produce and purify recombinant FAM79B protein is crucial for these studies, enabling researchers to conduct in vitro assays that elucidate its biological functions and potential as a therapeutic target. Overall, the study of FAM79B through recombinant protein techniques represents a promising avenue in molecular biology and medical research, aimed at unraveling its contributions to health and disease.
