Analytical Data
-
Gene name
PNR
- Application
-
Alternative Names
PNR；PNR；Trace amine-associated receptor 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14804
-
Expression Region
1-337aa
-
AA Sequence
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
-
Molecular Weight
38.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNR (Peroxisome Proliferator-Activated Receptor Gamma-1) is a nuclear receptor that plays a critical role in regulating various physiological processes, including lipid metabolism, glucose homeostasis, and inflammation. As a key transcription factor, PNR influences adipocyte differentiation and the development of insulin sensitivity, which are crucial for maintaining metabolic health. Recent studies have highlighted the significance of PNR in diseases such as obesity, type 2 diabetes, and metabolic syndrome. Given the rising prevalence of these conditions globally, research has increasingly focused on the potential of PNR as a therapeutic target. The development of PNR recombinant proteins has opened new avenues for studying its functions and interactions at a molecular level, facilitating the identification of novel ligands and understanding the complex regulatory networks involving PNR. By employing advanced techniques such as CRISPR/Cas9 gene editing, RNA sequencing, and high-throughput screening, researchers aim to elucidate the mechanisms by which PNR regulates metabolic pathways and to explore its therapeutic potential in combating metabolic disorders. The ongoing research into PNR recombinant proteins holds promise for the development of innovative treatment strategies, contributing to improved health outcomes in populations affected by metabolic diseases.
