Analytical Data
-
Gene name
ZNF480
- Application
-
Alternative Names
Zinc finger Protein 480; ZN480_HUMAN; ZNF480
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV37
-
Expression Region
1-516 aa
-
AA Sequence
MALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGISLPDLNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGSSYALGSNAEDKPIKKQLGVSFHLHLSELELFPDERVINGCNQVENFINHSSSVSCLQEMSSSVKTPIFNRNDFDDSSFLPQEQKVHLREKPYECNEHSKVFRVSSSLTKHQVIHTVEKPYKCNSCGKVFSRNSHLAEHCRIHTGEKPYKCNVCGKVFSYNSNFARHQRIHTREKPYECNECGKVFSNNSYLARHQRIHAEEKPYKCNECGKGFSHKSSLANHWRIYTGEKPYKCDECGKAFYRIALLVRHQKIHTGEKPYKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRIHTGEKPYKCNECGKAFSEYSGLSAHLVIHTGEKPYKCSECGKAFRHKLSLTNHQRIHTGERPYKCNECGKVFNRIAHLARHRKIHTGEKPYKCNECGKAFSRISYLAQHWTIHMG
-
Molecular Weight
85.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF480, a member of the zinc finger protein family, has garnered attention in research due to its potential roles in gene regulation and cellular processes. Zinc finger proteins are characterized by their distinctive structure that allows them to bind to DNA, RNA, or proteins, thereby influencing transcription and other cellular mechanisms. While the precise functions of ZNF480 remain to be fully elucidated, studies suggest that it may be involved in tumorigenesis, cell differentiation, and responses to stress. The exploration of ZNF480 recombinant proteins is pivotal, as it allows researchers to study the protein's function, interaction with other biomolecules, and its regulatory mechanisms in a controlled environment. Understanding ZNF480's biological role could provide insights into its potential implications in cancer biology and other diseases. Furthermore, recombinant proteins can be utilized in various applications, including drug development, therapeutic interventions, and as research tools in molecular biology. The ongoing investigation into ZNF480 not only aims to unravel its biological significance but also to harness its capabilities for future therapeutic strategies.
