Analytical Data
-
Gene name
ZNF479
- Application
-
Alternative Names
ZNF479; Zinc finger Protein 479; Zinc finger Protein Kr19; HKr19
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JC4
-
Expression Region
1-524 aa
-
AA Sequence
MAKRPGPPGSREMGLLTFRDIAIEFSLEEWQCLDCAQRNLYRDVMLENYRNLVSLGIAVSKPDLITCLEQNKESQNIKRNEMVAKHPVTRSHFTQDLQPEQGIKDSLQKVIPRTYGKCGHEKLQFKKCCKSVGEYEVHKGGYSEVNQCLSTTQNKIFQTHKYVKVFGKFSNSNRDKTRYTGNKHFKCNKYGKSFCMLSHLNQHQVIHTREKSYKCKECGKSFNCSSNHTTHKIIHTGEKPYRCEECGKAFSWSANLTRHKRTHTGEKPYTCEECGQAFRRSSALTNHKRIHTGERPYKCEECGKAFSVSSTLTDHKRIHTGEKPCRCEECGKAFSWSSNLTRHKRIHTREKPYACEECGQAFSLSSNLMRHRRIHTGEKPYTCEECGQDFRRSSALTIHKRIHTGERPYKCEECGKVFSLSSTLTDHKRIHTGERPYKCEECGKAFSLSSTLTDHKRIHTGERPYTCEECGKAFNCSSTLMQHKRIHTGEKPYKCEECEQAFKWHSSLAKHKIIHTGEKPYKCE
-
Molecular Weight
57.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF479, a member of the zinc finger protein family, has garnered increasing attention due to its potential roles in various biological processes, including transcriptional regulation, cellular differentiation, and stress responses. Recent studies suggest that ZNF479 may be involved in critical pathways related to oncogenesis and developmental biology, making it a compelling target for research. Its unique domain structure suggests specific DNA-binding capabilities, which could influence gene expression patterns in pivotal ways. The recombinant expression of ZNF479 enables researchers to investigate its functional properties in vitro and in vivo, paving the way for understanding its mechanistic roles within cells. Moreover, elucidating the functions of ZNF479 could provide insights into its contributions to diseases, particularly in cancer, where aberrations in zinc finger proteins commonly occur. Given the complexity of gene regulation and the significance of post-translational modifications, studying the recombinant form of ZNF479 may also help uncover novel regulatory mechanisms and interaction networks. This research could have broader implications for therapeutic strategies, potentially leading to the development of new interventions targeting ZNF479-related pathways in disease contexts. Overall, the recombinant protein studies of ZNF479 could significantly advance our understanding of its biological significance and therapeutic potential, thereby contributing to the fields of molecular biology and cancer research.
