Cat: PA1000-8425

Recombinant Human IRF4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IRF4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IRF4;MUM1;Interferon regulatory factor 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15306

  • Expression Region

    1-451aa

  • AA Sequence

    MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF RIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCA LNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSH PYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGP RGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDC RLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLLPYPEDNGQ RKNIEKLLSHLERGVVPWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKL ITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQ E

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IRF4 (Interferon Regulatory Factor 4) is a critical transcription factor that plays a significant role in the immune system, particularly in the regulation of immune responses. It is primarily expressed in lymphocytes, including B cells and T cells, where it regulates the differentiation, proliferation, and function of these cells. Research has indicated that IRF4 is essential for the development of distinct immune lineages, such as plasma cells and follicular helper T cells, and it significantly influences the production of immunoglobulins. Given its pivotal role in adaptive immunity, IRF4 has also been implicated in various diseases, including autoimmune disorders and cancers, particularly lymphomas. The investigation of IRF4 recombinant protein serves multiple objectives, such as elucidating its structural properties, understanding its interaction with other proteins, and exploring its potential as a therapeutic target. By using recombinant technology, researchers can produce the IRF4 protein in a controlled environment, facilitating studies on its functional dynamics and involvement in immune regulation. Furthermore, as scientists seek to develop novel immunotherapies, characterizing the function of IRF4 through its recombinant form may reveal insights into its potential manipulation for clinical benefit. Thus, the study of IRF4 recombinant protein is instrumental in bridging fundamental immunological knowledge with therapeutic applications, aiming to harness the immune system for the treatment of various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US