Analytical Data
-
Gene name
ZNF461
- Application
-
Alternative Names
ZNF461; GIOT1Zinc finger Protein 461; Gonadotropin-inducible ovary transcription repressor 1; GIOT-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAF7
-
Expression Region
1-563 aa
-
AA Sequence
MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS
-
Molecular Weight
92.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF461 (Zinc Finger Protein 461) is a member of the zinc finger protein family, which is characterized by the presence of zinc finger motifs that enable them to interact with nucleic acids. These proteins play crucial roles in various biological processes, including transcriptional regulation, chromatin remodeling, and the modulation of cellular responses to environmental stimuli. Recent studies have indicated that ZNF461 may be involved in key regulatory pathways that influence cell differentiation and proliferation. Its expression has been linked to several developmental processes, suggesting that understanding its function could provide insights into developmental biology and potential disease mechanisms. Moreover, the recombinant expression of ZNF461 protein in heterologous systems allows for detailed biochemical characterization, elucidation of its functional domains, and investigation of its protein-protein interactions. This research could also pave the way for therapeutic applications, particularly in conditions where ZNF461 activity is disrupted. Thus, the study of ZNF461 through recombinant protein technology is vital for unraveling its biological significance and therapeutic potential in various diseases, including cancer and genetic disorders.
