Analytical Data
-
Gene name
FAM46D
- Application
-
Alternative Names
TENT5D; FAM46D; Terminal nucleotidyltransferase 5D; EC 2.7.7.19; Non-canonical poly(A) polymerase FAM46D
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NEK8
-
Expression Region
1-389aa
-
AA Sequence
MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS
-
Molecular Weight
70.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM46D, or family with sequence similarity 46 member D, is a protein that has drawn significant attention in recent years due to its potential role in various biological processes and diseases, particularly in the context of cancer. Research indicates that FAM46D may play a crucial role in regulating cell proliferation, apoptosis, and differentiation, as it is involved in the maintenance of genomic stability. Its expression is notably associated with several hematological malignancies, including multiple myeloma, where mutations in the FAM46D gene are frequently observed. These mutations can lead to altered protein function, contributing to tumorigenesis and disease progression. Furthermore, emerging studies suggest that FAM46D may be implicated in immune response modulation, implicating its potential as a therapeutic target. The recombinant expression of FAM46D protein allows for detailed investigations into its structure-function relationship, leading to a deeper understanding of its biological significance. Additionally, this research could help elucidate the pathways through which FAM46D influences cellular behavior, paving the way for the development of novel diagnostic and therapeutic strategies for diseases where FAM46D is involved. Overall, the study of FAM46D recombinant protein not only enhances our understanding of its molecular mechanisms but also holds promise for future clinical applications.
