Analytical Data
-
Gene name
SLPI
- Application
-
Alternative Names
SLPI；WAP4；WFDC4；AntileukoProteinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03973
-
Expression Region
26-132aa
-
AA Sequence
SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SLPI (Secretory Leukocyte Protease Inhibitor) recombinant proteins has garnered significant interest due to the molecule's critical role in modulating immune responses and protecting epithelial tissues. SLPI is a serine protease inhibitor primarily expressed in epithelial cells, where it functions to inhibit various proteolytic enzymes, thereby preventing tissue damage during inflammation and infections. Its involvement in key biological processes, such as wound healing and microbial defense, has led researchers to explore its therapeutic potential in various conditions, including respiratory diseases, inflammatory disorders, and cancer. Recombinant SLPI production allows for the generation of high-purity proteins that can be used for functional studies, drug development, and potential clinical applications. Furthermore, the ability to engineer SLPI variants with enhanced properties offers opportunities for creating novel therapeutic agents with improved efficacy. As a result, the ongoing research into SLPI recombinant proteins aims not only to better understand their biological functions but also to leverage these insights for innovative treatment strategies in medicine.
