Analytical Data
-
Gene name
FAM128B
- Application
-
Alternative Names
MZT2B; FAM128B; MOZART2B; Mitotic-spindle organizing protein 2B; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NZ67
-
Expression Region
1-158aa
-
AA Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
-
Molecular Weight
42.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM128B, also known as the Family with Sequence Similarity 128 Member B, has emerged as an intriguing subject of study within the field of molecular biology and genetics due to its potential roles in cellular processes and disease mechanisms. It is a member of a gene family that is believed to be involved in various biological functions, including cell signaling, proliferation, and apoptosis. Research has indicated that FAM128B may play a significant role in certain cancers and metabolic disorders, making it a candidate for therapeutic target exploration. Recent advances in recombinant protein technology have enabled the production of FAM128B as a purified protein, facilitating detailed investigations of its structure, function, and interactions with other cellular components. By analyzing the recombinant FAM128B, researchers aim to uncover its specific roles in signaling pathways and its potential implications in disease, thereby enhancing our understanding of its biological significance. Furthermore, the study of FAM128B's interactions could lead to novel insights into targeted therapies for diseases where its dysfunction is implicated, paving the way for innovative treatment strategies. As research continues to elucidate the complexities surrounding FAM128B, it stands out as a promising candidate for further exploration in the context of cellular health and disease.
