Analytical Data
-
Gene name
TRDV2
- Application
-
Alternative Names
T cell receptor delta variable 2; TRDV2; hDV102S1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0JD36
-
Expression Region
20-115 aa
-
AA Sequence
AIELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCACDT
-
Molecular Weight
12.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRDV2 is a novel T cell receptor (TCR) alpha chain protein that has garnered significant attention in immunology and cancer research. It is particularly important due to its potential role in recognizing specific antigens presented by major histocompatibility complex (MHC) molecules. As an unconventional TCR, TRDV2 is predominantly expressed on gamma/delta (γ/δ) T cells, which are known for their unique functionalities in the immune response, including rapid cytotoxicity and involvement in tissue surveillance. The interest in TRDV2 is also driven by its potential application in immunotherapy, especially in targeting tumors that express specific antigens. Recent studies have focused on the structural and functional characterization of TRDV2, utilizing techniques such as X-ray crystallography and high-throughput sequencing to elucidate its binding affinities and specificities. Understanding the reactivity and mechanisms of TRDV2 could pave the way for novel therapeutic strategies, enhancing T cell responses against cancers and infectious diseases. Given the growing field of personalized medicine, TRDV2’s ability to be engineered or optimized for greater specificity makes it a promising candidate for developing TCR-based therapies that could improve clinical outcomes in immunological disorders. Overall, research into TRDV2 encompasses a multi-faceted approach, combining molecular biology, structural analysis, and clinical applications, promising significant advancements in the realm of targeted immunotherapies.
