Analytical Data
-
Gene name
FAM127C
- Application
-
Alternative Names
RTL8B; CXX1C; FAM127C; MAR8B; Retrotransposon Gag-like protein 8B; Mammalian retrotransposon derived protein 8B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q17RB0
-
Expression Region
1-113aa
-
AA Sequence
MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF
-
Molecular Weight
12.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM127C, also known as Family with sequence similarity 127 member C, is a protein encoded by the FAM127C gene, which has garnered significant attention in recent years due to its potential implications in various biological processes and pathological conditions. Research indicates that FAM127C may play a pivotal role in cellular signaling pathways, influencing processes such as cell proliferation, differentiation, and apoptosis. Its expression patterns have been linked to certain cancers, suggesting that it may function as a tumor suppressor or promoter depending on the cellular context. Given the emerging evidence of FAM127C’s involvement in critical regulatory mechanisms, studies focus on characterizing the protein's structure, function, and interactions with other cellular components. Additionally, recombinant FAM127C protein has been developed to facilitate in vitro assays aimed at uncovering its biological functions and exploring its potential as a therapeutic target. Understanding the precise role of FAM127C in disease mechanisms may lead to novel diagnostic and therapeutic strategies, highlighting the importance of ongoing research in this field. As scientists continue to unravel the complexities surrounding this protein, FAM127C could emerge as a key player in the development of innovative treatments for cancer and other disorders linked to its dysregulation.
