Analytical Data
-
Gene name
CLDN16
- Application
-
Alternative Names
CLDN16；PCLN1；Claudin-16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5I7
-
Expression Region
1-235aa
-
AA Sequence
MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLDN16, or Claudin-16, is a member of the claudin family of tight junction proteins, which play a crucial role in maintaining the integrity of epithelial barriers and regulating paracellular transport. Its expression is primarily found in the kidney, particularly in the thick ascending limb of the loop of Henle, where it is essential for the reabsorption of divalent cations, such as magnesium and calcium. Mutations in the CLDN16 gene lead to a rare genetic disorder known as Familial Hypomagnesemia with Hypercalciuria and Nephrocalcinosis (FHHNC), which is characterized by low magnesium levels, high calcium levels in urine, and an increased risk of kidney stones. The study of CLDN16 and its recombinant protein is critical for understanding its functional mechanisms in cell junction integrity and ion transport. Recombinant CLDN16 protein can be used in various experimental studies to elucidate its role in tight junction dynamics, its interaction with other junctional proteins, and its contributions to renal pathophysiology. Furthermore, exploring potential therapeutic avenues for conditions arising from its dysfunction makes CLDN16 a protein of significant interest in both fundamental research and clinical applications. Understanding the structure and function of CLDN16 through recombinant protein studies could lead to novel strategies for managing related renal disorders and improving patient outcomes.
