Analytical Data
-
Gene name
ZNF350
- Application
-
Alternative Names
KRAB zinc finger Protein ZFQR; ZBRK1; ZFQR; Zinc finger and BRCA1 interacting Protein with a KRAB domain 1; Zinc finger and BRCA1-interacting Protein with a KRAB domain 1; Zinc finger Protein 350; Zinc finger Protein ZBRK1; ZN350_HUMAN; ZNF350
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZX5
-
Expression Region
1-532 aa
-
AA Sequence
MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKL EQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQF LLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPA SQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCE KAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSG LIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLA NRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF350, a member of the zinc finger protein family, has garnered attention in the field of molecular biology due to its potential roles in gene regulation and cellular processes. Zinc finger proteins are characterized by their ability to bind DNA, RNA, or proteins, and ZNF350 is believed to act as a transcription factor, influencing gene expression in various biological contexts. Research indicates that ZNF350 may be involved in critical processes such as cell differentiation, proliferation, and apoptosis, making it a target of interest for understanding developmental biology and disease mechanisms, including cancer. As a recombinant protein, ZNF350 can be produced in vitro, providing researchers with a valuable tool to study its functional properties, interactions with other biomolecules, and regulatory pathways. Investigating the structure-function relationship of ZNF350 through recombinant technology has the potential to unveil new insights into its role within the cellular environment and could lead to novel therapeutic strategies aimed at manipulating its activity in pathological conditions. The increasing focus on the implications of zinc finger proteins in gene therapy and other biotechnological applications underscores the significance of ZNF350 in contemporary biomedical research.











