Analytical Data
-
Gene name
CLDN18
- Application
-
Alternative Names
CLDN18;Claudin-18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56856
-
Expression Region
28-80aa
-
AA Sequence
DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
-
Molecular Weight
32.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLDN18, or Claudin 18, is a member of the claudin family of tight junction proteins that play a crucial role in maintaining epithelial barrier function and regulating paracellular permeability. Research has highlighted its significant involvement in various physiological processes, including maintaining tissue architecture and facilitating selective ion transport. In particular, CLDN18 has garnered attention in cancer research, as its expression is often altered in various malignancies, notably in gastric and pancreatic cancers, where it is associated with tumor progression and metastasis. The study of recombinant CLDN18 proteins has emerged as a promising area of investigation, providing insights into its structure-function relationships and potential therapeutic applications. By producing recombinant CLDN18, researchers can explore its biological activity, understand its role in disease mechanisms, and investigate its potential as a biomarker or therapeutic target. Moreover, the engineering of CLDN18-based constructs may lead to the development of novel treatments, such as targeted drug delivery systems or immunotherapies aimed at activating the immune response against CLDN18-expressing tumors. Overall, the ongoing research on CLDN18 recombinant proteins is essential for enhancing our understanding of epithelial biology and providing innovative strategies for cancer diagnosis and treatment.











