Analytical Data
-
Gene name
CLDN2
- Application
-
Alternative Names
CLDN2;Claudin domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57739
-
Expression Region
29-80aa
-
AA Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQ AA
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Claudin-2 (CLDN2) is a member of the claudin family of tight junction proteins, which play a crucial role in maintaining epithelial barrier function. Recent studies have shown that CLDN2 is not only essential for the integrity of tight junctions but also involved in various physiological and pathological processes, including paracellular permeability and inflammatory responses. Its expression is significantly upregulated in several diseases, such as inflammatory bowel disease (IBD), kidney disorders, and certain types of cancer, making it a potential target for therapeutic intervention. Recombining CLDN2 protein allows researchers to study its structure-function relationship and interactions with other cellular components. This recombinant protein is pivotal for elucidating CLDN2’s role in cellular signaling pathways and disease mechanisms. Furthermore, it provides a valuable tool for developing antibody-based diagnostics and therapeutics. The availability of recombinant CLDN2 enables the exploration of its impact on epithelial barrier dysfunction and its potential implications in drug delivery systems. Overall, research on CLDN2 recombinant protein contributes significant insights to our understanding of tight junction biology and its relevance in disease conditions, leading to the potential for novel therapeutic strategies.











