Analytical Data
-
Gene name
FAM126A
- Application
-
Alternative Names
Down regulated by Ctnnb1 a; Down regulated by CTNNB1 protein A; Down-regulated by CTNNB1 protein A; DRCTNNB1A; FAM126A; Family with sequence similarity 126 member A; HCC; HLD5; HYCC1; HYCCI_HUMAN; Hyccin; Protein FAM126A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYI3
-
Expression Region
1-521aa
-
AA Sequence
MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLELLSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQRPPSISITLSTD
-
Molecular Weight
84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM126A, a member of the FAM126 family, has garnered attention due to its potential implications in various biological processes and diseases, particularly in cancer and neurological disorders. Recent studies have revealed that FAM126A plays a significant role in cellular functions such as cell proliferation, differentiation, and apoptosis. Its involvement in the regulation of signaling pathways, especially those related to tumorigenesis, has prompted researchers to investigate the molecular mechanisms underlying its function. Given that FAM126A is expressed in several tissues, its dysregulation has been linked to pathologies, making it a promising target for therapeutic interventions. The development of recombinant FAM126A protein provides a valuable tool for elucidating its biochemical properties and interactions at the molecular level. By enabling the exploration of protein structure-function relationships, recombinant FAM126A can facilitate the identification of its roles in cancer biology and other diseases, thereby paving the way for novel strategies in diagnosis and treatment. Understanding FAM126A's mechanisms of action may also contribute to the broader field of personalized medicine, as alterations in its expression and function could serve as biomarkers for disease prognosis and therapy response. As research progresses, the establishment of FAM126A as a significant player in cellular pathways is likely to enhance our understanding of its potential as a biomarker and therapeutic target in various clinical contexts.
