Analytical Data
-
Gene name
DDH2
- Application
-
Alternative Names
DDH2；DDAH；G6A；NG30；Putative hydrolase DDAH2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52895
-
Expression Region
1-323aa
-
AA Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
-
Molecular Weight
52.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDH2, or Dipeptidyl Dipeptidase II, is an interesting target in the field of biochemistry and molecular biology due to its key role in various physiological processes and its implications in disease states. It is involved in the degradation of peptides, influencing immune responses and cellular signaling pathways. Understanding the structure and function of recombinant DDH2 protein can provide insights into its enzymatic mechanisms and interactions with substrates. Researchers are particularly focused on the potential therapeutic applications of modulating DDH2 activity, especially in conditions such as autoimmune diseases and cancer, where peptide regulation can significantly affect disease progression and treatment outcomes. The recombinant expression of DDH2 allows for detailed studies into its catalytic properties and interaction dynamics, facilitating the development of inhibitors or enhancers that could serve as novel therapeutic agents. Additionally, the exploration of DDH2's role in metabolic pathways emphasizes its significance in drug discovery and development. Overall, the study of DDH2 recombinant protein contributes to a deeper understanding of cellular metabolism and presents opportunities for innovative therapeutic strategies.
