Analytical Data
-
Gene name
TMEPAI
- Application
-
Alternative Names
PMEPA_HUMAN; PMEPA1; Prostate transmembrane Protein; androgen induced 1; Solid tumor associated 1 Protein; Solid tumor-associated 1 Protein; STAG1; TMEPAI; Transmembrane prostate androgen induced Protein ; Transmembrane prostate androgen-induced Protein; Transmembrane; prostate androgen induced RNA
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969W9
-
Expression Region
181-280 aa
-
AA Sequence
NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEPAI (Transforming Growth Factor Beta Inducible Protein) is a critical protein involved in various cellular processes, including fibrosis, inflammation, and cancer progression. Its expression is often upregulated in response to TGF-β signaling, which is integral to the regulation of extracellular matrix components and tissue remodeling. Research has shown that TMEPAI plays a significant role in the pathogenesis of fibrotic diseases and tumorigenesis, making it a potential therapeutic target. Understanding the structure and function of TMEPAI through recombinant protein studies can provide insights into its biological mechanisms and interactions at the molecular level. The recombinant production of TMEPAI allows for the generation of large quantities of the protein, facilitating detailed functional assays, structural analysis, and the development of inhibitors or antibodies for both research and therapeutic purposes. Additionally, studying TMEPAI can enhance our understanding of its role in disease processes, potentially leading to novel strategies for treatment. The ongoing exploration of TMEPAI's implications in limiting fibrosis and cancer progression highlights the importance of this protein in biomedical research, paving the way for innovative approaches to tackle related diseases.
