Analytical Data
-
Gene name
TMEM82
- Application
-
Alternative Names
TMEM82; Transmembrane Protein 82
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0PJX8
-
Expression Region
1-343 aa
-
AA Sequence
MFSLPSLPSWLPGLPSLEWGSSLLDSLLQGLIGALGVLVLNSLLKVYFFVGCANDPQRRPEKERLRAQWASLETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAERLQLYLLCQYSLGCGLTCGLSFLQEGAPHRTLNLLLSLGLATLLGLGARRLHRHVCRLYELHSSQRYCGVCLGLLAHAHGLPQLLGRALAIAFAVGDLAAVALINQDFLTTSEAMRFWTPLTICYTLLVIYMQEEQRQHPGLQSQVQTVLVRMGGLFVLLLTVGRWLDLLGILVSLLGELWCLVGVRTLLDLCQIQDFPSQRPPVSTPSQPLPSAPQSQSSAPS
-
Molecular Weight
63.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM82 (Transmembrane Protein 82) is a member of the transmembrane protein family that has garnered significant interest in recent years due to its potential roles in various cellular processes and implications in disease mechanisms. Initial studies have suggested that TMEM82 may be involved in regulating cellular signaling pathways, and it is suspected to play a role in cell proliferation, differentiation, and apoptosis. Notably, aberrant expression of TMEM82 has been linked to certain malignancies, indicating that it could serve as a biomarker for cancer progression or a potential therapeutic target. The recombinant expression of TMEM82 in suitable systems facilitates the detailed study of its structure, function, and interactions with other cellular components. By producing TMEM82 as a recombinant protein, researchers can investigate its biochemical properties, post-translational modifications, and potential interactions with other proteins or lipids. Additionally, understanding the functional mechanisms of TMEM82 may provide insights into its role in disease context, particularly in cancer. Overall, the study of TMEM82 through recombinant protein technology is essential for elucidating its biological significance, paving the way for novel therapeutic strategies targeting this protein in pathological conditions.
