Analytical Data
-
Gene name
ETV7
- Application
-
Alternative Names
ETS related protein Tel2; Ets transcription factor TEL-2b; Ets transcription factor TEL2; ETS translocation variant 7; ets variant 7; ets variant gene 7 (TEL2 oncogene); ets variant gene 7; ETS-related protein Tel2; ETV7; ETV7_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y603
-
Expression Region
1-341aa
-
AA Sequence
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
-
Molecular Weight
65.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETV7, a member of the ETS (E26 Transformation-Specific) transcription factor family, has garnered significant attention in recent years due to its involvement in various biological processes and its potential role in cancer progression. Initially identified as a crucial regulator in mouse embryonic development, ETV7 has been implicated in the regulation of genes associated with cell proliferation, differentiation, and survival. In oncological studies, overexpression of ETV7 has been linked to several malignancies, suggesting its potential as a biomarker for tumor progression and a target for therapeutic intervention. Moreover, ETV7's interactions with other signaling pathways, such as those regulated by growth factors and cytokines, highlight its importance in cellular responses to environmental cues. The research into the recombinant expression and characterization of ETV7 proteins aims to elucidate its functional mechanisms and contribute to understanding its role in oncogenesis. Efforts to produce ETV7 as a recombinant protein enable detailed biochemical analyses, including binding affinity studies and interaction assays with other molecular partners, which could reveal novel insights into its regulatory networks. Overall, the exploration of ETV7 as a recombinant protein serves not only to advance basic research in transcriptional regulation but also to uncover its potential as a therapeutic target in the fight against cancer.
